![]() Zotero experienced an error updating your document. GoodReader iOS app can be used to mark up PDFs - highlighting, boxing, typing. Most of the heavy lifting is done by the web browser plugin or in an external PDF viewer. If a PDF is available, the Connector can save it to your library to read later, and it can even. ![]() The Zotero Connector automatically senses content as you browse the web and allows you to save items to Zotero with a single click. Have tried all remedies suggested on your support site, now I need professional help! Chrome plug in zotero for mac 2016 pdf Chrome plug in zotero for mac 2016 pdf Then email marked up PDF to yourself, download on Mac/PC and drag PDF into Zotero Desktop app. Zotero is a free, easy-to-use, open-source tool to help you collect, organize, annotate, cite, and share research. Installed the Firefox and word add-on as described, but get an error message in word, when I want to add a citation (see below). The original Firefox extension has been converted to a Zotero connector extension, comparable to the connector available for Google Chrome and Safari.Got a new PC setup with Office2016 and Windows10.
0 Comments
![]() CSV/TSV (Comma/Tab Separated Values) and Excel spreadsheet files csfasta files represent the color calls generated by the SOLiD sequencing system. HQ625581 MRVMGIPRNWPQWWIWGILGFWIMLMCRVEENSWVTVYYGVPVWKEATTTLFCASDAKAYĪBI. HQ625568 MRVRGTQRNWPQWWIWTSLGFWIILMCR-GNLWVTVYYGVPVWTDAKTTLFCASDAKAY HQ625588 MRVMGKWRNCQQWWIWGILGFWIILICN-AEQLWVTVYYGVPVWKEAKTTLFCASDAKAY HQ625572 MRVKGILKNYQQWWIWVILGFWMLMICNVVGNQWVTVYYGVPVWREAKATLFCASDAKAY HQ625589 MRVKGRSRNYPQWWVWGILGFWMFMICNGVGNRWVTVYYGVPVWKEAKATLFCASDAKAY HQ625570 MRVMGMWRNYPQWWIWGILGLWM-ICSVVGKLWVTVYYGVPVWTDAKATLFCASDAKAY An example Clustal file: CLUSTAL W (1.74) multiple sequence alignment Ĭlustal format files are used to store multiple sequence alignments and contain the word clustal at the beginning. The Clustal format is used by the well known multiple sequence alignment programs ClustalW, ClustalX and Clustal Omega. pd4 are not currently supported for import. Currently it does not import other fields, restriction cut sites or primer binding sites. This will import name, description, topology, sequence and annotations. Geneious can import annotated sequences files in the standard Clone Manager molecule format. You can use a BED file to annotate existing sequences in your local database, import entirely new sequences, or import the annotations onto blank sequences. The BED format contains sequence annotation information. PHYLIP, PAUP*, Figtree, other tree building programs Geneious Prime version can import the following file formats: Format If no reference sequence is present in the imported documents, you will be prompted to select a reference from existing documents in your database, or load onto a blank sequence. Sequence IDs in the files must match for the import to proceed correctly. The reference sequence will be loaded first, followed by the annotation and assembly files. Any combination of these files can be selected and then dragged and dropped into Geneious. In version 11.1 onwards, Geneious supports bulk import of a mixture of SAM, BAM, GFF, BED, VCF and Fasta formatted files, allowing sequence, annotation and assembly information to be imported in a single step. In version 10.1 and above zip files containing multiple files and subfolders can also be imported. If the folder has subfolders, the folder structure will be retained when it is imported into Geneious. To import an entire folder and all its subfolders and files into Geneious Prime in one step, click the Add button and choose Import Folder, or go to File → Import → Folder. If no folder is selected, you will be prompted to choose a folder during the import. The different file formats that Geneious can import are described in detail in the next section.įiles can also be dragged and dropped from your hard drive directly into Geneious and the file type will automatically be determined.įiles imported from disk are imported directly into the currently selected local folder within Geneious. This will open up a window where you can either select the file format or let Geneious autodetect the format. To import files from local disks or network drives, click the Add button in the Toolbar and select Import Files, or go to File → Import → Files. ![]() Importing data from the hard drive to your Local folders All import and export options can be accessed via the Add and Export buttons in the Toolbar, or via the File menu. We will be adding reviews of the various programs as we find time.Geneious Prime is able to import raw data from different applications and export the results in a range of formats. To help you find the best trace viewer for your needs we have listed all the trace viewers we are aware that exist. Many come with additional features like manual editing, BLAST analysis, or the ability to view the raw data. There are many good trace viewers and most are free. To visualize the trace you need a trace viewing program. PeakTrace is a basecaller and improves your DNA sequences, but will not allow you to view the peaks in the. DNA Sequencing Reaction Clean-up using Phenol & Butanol.Tris EDTA DNA Sequencing Resuspension Buffer.Exonuclease I – Shrimp Alkaline Phosphatase Clean Up of PCR Products.Auto PeakTrace 6 Online Activation Guide.How to Update the PeakTrace License on Linux. ![]() What Are the Principles of Art The principles of art include harmony, balance, unity, proportion, scale, rhythm, movement, emphasis, variety, and contrast. Other participating artists include Thongmai Thepram, Vipoo Srivilasa and Pichai Pongsasaovapark (Thailand) Marisa Papen, Ilse Van Roy and Nick Ervinck (Belgium) Mu Pan (Taiwan and the US) Daniel Martin Diaz (US) Alessandro Sicioldr (Italy) Stéphane Blanquet (France) and Michael Hutter (Germany). Unity in art refers to the overall or broader idea of the artwork appearing visually pleasing, where all art elements work in unison. It is carved out of wood by Thai artist Suwat Boontam and plays a visual symphony of lights and musical notes created by the public on a live-streamed website. ![]() The centrepiece of the show is The New Ark, an interactive sculpture designed by artist Director Jacq to revive and reconnect the universal bond that keeps life together. We treat our planet, animals, and other beings with no sense of responsibility, to a point that we are endangering our own existence. ![]() With the original ark gone, the rules between humans and the sacred seem to have disappeared as well. Upgrade your level of understanding of Unity with clear and carefully composed tutorials from professional artists. Harmony is definitely not monotony but also not chaos. Certain element can be repeated, yet they still look and feel like they are lending themselves to a whole. Your gift is essential to our mission of serving the community through the arts and art. But in reality, it seems to be gone forever. Harmony in art overall is achieved when the elements of an artwork come together in a unified way. Please consider supporting the Frist Art Museum with a donation. Centuries later, people throughout the world have been trying to find it, including Indiana Jones in Steven Spielberg's classic film. There are numerous ways to create unity in art. Unity and harmony are similar, but unity is more broad. The sacred artefact was stolen during one of the invasions of Jerusalem. Unity is the principle of art that gives an artwork a feeling of oneness. The idea of the exhibition is derived from the Ark of the Covenant, a gold-covered wooden chest that contained the original Ten Commandments. (Photo courtesy of River City Bangkok)Ī collaboration with Art Can Die, it gathers 13 international artists who have created projects that address universal unity. Highlights in the game, and in the book, include the different areas of Paris, each with their own identity and population, towering buildings bigger than any Assassin’s Creed game so far and an amazing range of locations and action.Artwork by Michael Hutter. In art and design, the term unity refers to the way various elements come together to create a sense of wholeness. Continuing in the footsteps of this already world-renowned franchise, Assassin’s Creed Unity brings to life a time of unrest and disorder in one of the greatest cities in the world, promising to be the biggest and best experience yet. Marrying intricately detailed environments and next-gen capabilities, Paris comes to life around you and immerses you in the grit and grime of a city in turmoil. The recently announced Assassin's Creed: Unity takes players into the heart of the French Revolution. Repetition is the use of elements more than once in an. Unrealistic Proportions Sometimes exaggerated or distorted proportions are purposefully used to convey a particular meaning or message. In their compositions, artists can create unity through repetition, continuation, simplicity, and proximity. Recognized for having some of the richest, most-engrossing art and storytelling in the industry, Assassin s Creed transcends video games, branching into other entertainment experiences including comic books, novels, short films and an impressive merchandise line-up. Unity in art is a principle in which the elements of art are placed in such a way that it creates a wholesomeness resulting in unity in the artwork’s composition. ![]() Unity adds order to a composition and helps us see it. With 73 million units sold worldwide, Ubisoft s Assassin s Creed franchise is established as one of the best-selling game series ever. The beauty of a tree and the positive power of connection have inspired the creation of this artwork Tree of Unity. Unity, located on the A Line (Blue) tunnel walls between 7th Street/Metro Center Station and Pico Station, was the first artwork to be. Unity is created when there is a relationship between the different elements in a design or artwork. It will no longer be a PlayStation exclusive once it releases on PC system in February 2023. Use the standard Windows updating process to apply this Windows version. No, Housemarque used Unreal Engine 4 in the creation of Returnal. We recommend players keep up to date with the latest Windows 10 or Windows 11 version. Returnal PC System Requirements FAQs Is Returnal Unreal Engine 5? However, it’s currently unclear if it will be compatible with the Steam Deck. Use your psychic skills to solve puzzles that span both realms, learn extremely unpleasant secrets, and avoid encounters with The Maw, a monster born of an unimaginable tragedy. Returnal will be available on both Steam and the Epic Games store once it releases. GPU – NVIDIA RTX 3080 Ti (12 GB) / AMD Radeon RX 6950 XT (16 GB).NOW READ: Best GPU for ray tracing – AMD and Nvidia graphics cards Ray Tracing System Requirements ![]() CPU – Intel i7-9700K (8 core 3.7GHz) / AMD Ryzen 7 3700X (8 core 3.6GHz) The Deluxe Edition includes: The Medium (game) Original Soundtrack - co-composed by legendary Japanese composer Akira Yamaoka and Arkadiusz Reikowski The Art of The Medium - an official digital album that will lead you through the game’s unsettling world.GPU – NVIDIA RTX 3080 (10 GB) / AMD Radeon RX 6800 XT (16 GB).GPU – NVIDIA RTX 2070 Super (8 GB) / AMD Radeon RX 6700 XT (12 GB).So, heres everything you need to about the system requirements for The Medium. Looking for an upgrade Try our easy to use The Medium set up guides to find the best, cheapest cards. CPU – Intel Core i5-8400 (6 core 2.8GHz) / AMD Ry(6 core 3.4GHz) Its coming out on January 28th, and PC players will no doubt be wondering what kind of requirements it has if theyve seen it at all. The Medium will run on PC system with Windows 10 (64bit version only) and upwards.GPU – NVIDIA GeForce GTX 1070 (8 GB) / AMD Radeon RX 5600 XT (6 GB).GPU – NVIDIA GeForce GTX 1060 (6 GB) / AMD Radeon RX 580 (8 GB).While not nearly as intensive of a game as some other recent PC releases, technically speaking, it does offer visually stunning cutscenes.Returnal PC System Requirements Minimum System Requirements Players must take on the role of one of five classes and grow strong enough to take down her hellish forces. This upcoming Diablo adventure centers around the fact that the Queen of the Succubi, Lilith, has been summoned by cultists and brought into the world of Sanctuary. A configuration more powerful than this will lead the game to run more smoothly. Diablo 4 players also need 64-bit Windows 10 and at least 8 GB of memory to play the game. The Medium PC System Requirements steamcommunity This thread is archived New comments cannot be posted and votes cannot be cast comments sorted by Best Top New Controversial Q&A blubzzz 3070 XC Additional comment actions SSD for recommended but HDD for high/ultra Huh. At the very minimum, you'll want to have either an NVIDIA GeForce GTX 660 or AMD Radeon R9 280 for your GPU as well as either an Intel Core i5-2500L or AMD FX-8100 as your CPU. It really depends on your laptop or computer setup. Not to mention the hack-and-slash adventure mechanics and magical fighting abilities, while fun, aren't as complex as some other games. This is typically the case for Diablo games, since they employ that iconic top-down view, which doesn't require quite as much attention to detail on objects in each scene. While Diablo 4 has some visually stunning cutscenes, normal gameplay is really not all that technically demanding on the CPU or GPU. Graphics: NVIDIA GeForce RTX 3080 NVIDIA GeForce RTX 40 Series for fully supported DLSS3 or AMD Radeon RX 6800 XT.Processor: Intel Core i7-8700K or AMD Ryzen 7 2700X.Graphics: NVIDIA GeForce RTX 2060 or AMD Radeon RX 5700 XT.Processor: Intel Core i7-8700K or AMD Ryzen 2700X.Graphics: NVIDIA GeForce GTX 970 or AMD Radeon RX 470.Processor: Intel Core i5-4670K or AMD Ryzen 1300X.Storage: SSD with 90 GB available spaceĭiablo 4: Medium (Recommended) PC Spec Requirements As you climb into the higher tiers of ray-tracing at resolutions greater than 1080p, you’ll probably need to invest in an SSD to appease the data transfer gods.Graphics: NVIDIA GeForce GTX 660 or AMD Radeon R9 280. ![]()
This was changed to "What are your orders, pack leader?". * In the labs, someone asks "What are your orders, Herr Oberführer?". In the German version, the word "slowenian" was removed. * A drunk soldier in the wine cellar under the cafe (map: village1) babbles: "Shut up you slowenian swine". * The speech "Wie geht's, Willie?" (How are you, Willie?) has been replaced by "Was ist passiert, Willie?" (What happened, Willie?), removing any sense from this talk. * a speech of Hitler about the Reichstag (map: dam) was deleted and replaced by classical music Found in a more-or-less secret room in the village (accessible via the rooftops). * A picture of the "Führer" (Hitler) was changed to an odd-looking guy without beard but with the well-known army cap. The funniest thing about this is the packaging which shows Doktor Zan (appearing at the very beginning of the game when he fries our comrade) - and on his jacket, you can clearly see the Nazi emblem (an eagle sitting on a circle in which is a swastika).Įven more changes to the German version, most of them regarding speech:* The "Horst-Wessel-Lied" (a Nazi song) was changed to a classical piece - the same is being played on a record player in the first outdoor mission. With this new storyline, the game makes absolutely no sense. They altered some of the names, too: Himmler is now called "Holler" and Oberst von Bülow has been renamed too. It is clear that this "background" was made up for the only purpose of getting the game past the German feds - the word "Nazi" is a red sheet for them. No word of Himmler and his dark plans, no Nazis at all. German versionįor the German release, the story was altered: You fight against the "Wolf-Sekte" (Cult of the Wolf), which is very dangerous to the freedom of the country because of their dark experiments. But this does not mean it is illegal to just own the game. In addition, the game is violating §86a of Germany's penal code (for using characteristics of unconstitutional organizations), therefore it is illegal to produce, distribute, import, export and use it in the public. The German version followed April 30, 2002.įor more information about what this means and to see a list of games sharing the same fate, take a look here: BPjS/BPjM indexed games. On February 28, 2002, the English version of Return to Castle Wolfenstein was put on the infamous German index by the BPjS. CastleĬastle Wolfenstein is based on Castle Wewelsburg which Heinrich Himmler used for occult rituals and practices. Return to Castle Wolfenstein appears in the book 1001 Video Games You Must Play Before You Die by General Editor Tony Mott. Games with officially released source code.3D Engine: id Tech 3 (Quake III: Arena).The game also features a multiplayer component in which players are split into Axis and Allies sides with each a set of objectives to complete. The player's arsenal includes among others a Luger, MP 40 submachine gun, Mauser rifle with sniper scope, flamethrower, dynamite and grenades. ![]() ![]() This division was founded by Heinrich Himmler and is trying to find the grave of Saxon warlord Heinrich I to bring him back to life. The game puts the player in the combat boots of Blazkowicz, who will first have to escape the castle and report back to his superiors, and afterwards restart the hunt for the SS Paranormal Division. Return to Castle Wolfenstein is a first-person shooter and a reboot of Wolfenstein 3D. Blazkowicz manages to escape his cell by killing the guard. Agent One is subsequently tortured to death by his interrogator, but B.J. Two secret agents are captured while they are investigating Nazi Germany's occult activities in Castle Wolfenstein. Coatings are generally used to reduce moisture, and white enamel with primer has been found to be particularly effective. Wood can be used, and the type of wood should be chosen based on availability, cost and growth time, average density, high stiffness, and breaking strain. Although natural fibers are susceptible to quality variations, high moisture uptake and low thermal stability that make them undesirable for larger blades, small turbines can still take advantage of them. Full mounting sets called "tower kits" are available.Ī range of synthetic materials including carbon fiber reinforced polymers, nanocomposites, and E-glass-polyester are available. Ground mounted small wind turbines are typically supported by four guy-wire, and a gin pole used to raise and lower the tower. To optimize efficiency, the tip speed ratio (the ratio of blade tip speed to wind speed) and lift-to-drag ratio should be kept at optimal levels. Most small wind turbines are horizontal-axis wind turbines, but vertical axis wind turbines (VAWTs) may have benefits in maintenance and placement, although they are less efficient at converting wind to electricity. Turbine blades for small-scale wind turbines are typically 1.5 to 3.5 metres (4 ft 11 in – 11 ft 6 in) in diameter and produce 0.5-10 kW at their optimal wind speed. The Canadian Wind Energy Association considers small wind turbines to be up to 300 kW, while the IEC 61400 standard defines them as having a rotor area smaller than 200 m 2 and generating voltage below 1000 Va.c. They usually produce between 500 W and 10 kW, with some as small as 50 W. They use a direct drive generator and use a tail fin to point into the wind, whereas larger turbines have geared powertrains that are actively pointed into the wind. Small wind turbines often have passive yaw systems as opposed to active ones. ![]() These turbines are typically smaller than those found in wind farms. Small wind turbines, also known as micro wind turbines, generate electricity for small-scale use. ![]() The remote layout may slightly vary, but you’ll use the same keys. AMAZON PE59CV DR49WK Fire Stick Alexa Voice Remote Control click image to enlarge YOUR REMOTE HAS BEEN DISCONTINUED, BUT Click ALLREMOTES. Press and hold the Left button and Menu button for at least 12 seconds. In this case, you’ll reset your remote as follows. Unplug your Firesticks power cable, and then wait for at least 60 seconds. If your Fire TV Stick remote doesn’t look like the above, yours is either a 2nd generation, 3rd generation, Voice Remote Lite, Smart TV Remote, or Soundbar remote. RELATED: How to Update the Amazon Fire TV Stick Reset the 2nd and 3rd Generation, Voice Remote Lite, Smart TV Remote, and Soundbar Remote The oldest models which use Bluetooth have a range of about 30 feet. Place the batteries back in your remote. Unlike traditional remote controls that use an infrared signal, the Fire Stick's remote connects with either Bluetooth or Wi-Fi.Connect your Fire TV Stick’s power cord so the device turns on, then wait one minute.The remotes we sell are the 2nd Gen (DR49WK G).No any program needed, only put into brand new battery will work well. There are two versions for Amazon fire tv stick remote: 1st Gen (DU3560) and 2nd Gen (DR49WK G). We will also provide you with various tips and tricks to help you get the most out of this trustworthy gadget. New 2nd Gen Voice Remote DR49WK B for Amazon Fire TV Box & Amazon Fire TV Stick. Let go of the buttons and wait for five seconds. How to Fix Firestick Remote Not Working in 1 Minute or Less Is your Firestick Remote Not Working The following guide will explain this issue and provide numerous methods to fix this device.On your remote, press and hold down the Left and Menu buttons at the same time for 12 seconds.Disconnect your Fire TV Stick’s power cord and wait for one minute.Reset the 1st Generation Fire TV Stick Remoteįire TV Stick’s 1st Generation remote doesn’t offer the Power and Volume buttons, but you can still reset it using the following steps. When your Fire TV Stick’s home screen opens, on your remote, press and hold down the Home button for 40 seconds.On the Vizio IT IS suppose to be disabled already. Reinsert the batteries into your remote and turn on your Fire TV Stick. NOTE: GO TO SETTINGS ON YOUR TV AND DISABLE HDMI-CEC.THIS MAY WORK BUT NOT ALWAYS.Unplug your Fire TV Stick and wait for a minute. Our remote to the Fire Stick was lost, possibly accidentally thrown in the trash, sometime around Halloween.Continue holding the Home button for at least 10 seconds. Press and hold the Home button on your Fire TV remote. ![]() ![]() Let go of the Home button, then press the Menu button nine times. Here's how to pair a Fire Stick remote: Plug in your Fire Stick and make sure that it's on.Press and hold down the Home button and then press the Menu button (three horizontal lines) three times.If you have the Basic Edition remote, which looks like the below, you will reset it as follows. Reset the Basic Edition Fire TV Stick Remote ![]() Right-clicking on the desktop icons for Computer or Network, then clicking Map Network Drive:.Opening the Network and Sharing Center in the Windows Control Panel and clicking Tools, then Map Network Drive:.Opening a folder in Windows Explorer and clicking Tools, then Map Network Drive:.This can be accomplished by using one of the following methods: To map a drive using the Map Network Drive Wizard, use the following steps: Method 1: Mapping Drives using the Map Network Drive Wizard ![]() Mapping Drives using the Map Network Drive Wizard.Once the WebDAV Redirector has been installed, you can map drives to your web site using WebDAV. Mapping Drives using the WebDAV Redirector Click Yes when promoted to restart the computer.When the Add Features Wizard has finished, click Close.In the Add Features Wizard, check the Desktop Experience box, and then click Next.In the details pane, click Add Features. ![]()
If you take too long to find an item the customer is looking for, they will become less interested in it and therefore pay less. As mentioned earlier, you are trying to complete sales to earn money. The hidden object gameplay is also made more exciting and realistic with time element involved. This keeps you sharp and keeps your eyes keen. ![]() Seeing your barn progress from a broken down shed into a stylish and modern safe place for your animals to endure the winter will definitely fill you with a sense of accomplishment.įun, challenging, and rewarding Hidden Object gameplay!įinding the hidden objects is challenging and fun! In some hidden object scenes, the items are camouflaged so well that they are almost blended into the background, making it impossible to spot, yet so very rewarding when you eventually find it. We won't go into too much detail as we don't want to spoil the story for you, but we, ummm, cannot confirm nor deny if we were moved to tears at some point! The characters have some fun and quirky lines as you hang around the barn and see the events unfold, and since you can choose to enter your name when creating a new game, it feels like you’re actively participating in the renovation efforts when the characters talk to you directly and refer to you by your designated name.Īs you complete sales, you earn money and can renovate or upgrade your barn. Why do we say that? This is because we found the storyline easygoing yet heartwarming, and there are several subplots that show up as the story progresses. ![]() This plot, though simple, is very well weaved into the game’s hidden object dynamic. ![]() This great game begins with a cute little cinematic explanation for the game’s premise: rancher Joe and his grandson Tom are teaming up to sell off a bunch of old junk to raise money, so that they can fix up the dilapidated barn they purchased from their neighbor. Playrix » Building & Farm » Hidden Object » What is this game about?īarn Yarn combines hidden object gameplay elements with time management, and creates this beautiful game that is set in a farm. Tales of Xillia®2 & © 2012 BANDAI NAMCO Games Inc. This item may be used with up to 2 activated PlayStation®3 systems associated with this Sony Entertainment Network account. This item is being licensed or sublicensed to you by Sony Computer Entertainment America and is subject to the Network Terms of Service and User Agreement, this item’s use restrictions and other applicable terms located at If you do not wish to accept all these terms, do not download this item. Leia - Judes best childhood friend was a. Product details: Alvin (Tales of Xillia)This cute pin was only available as a capsule toy in Animate shops Show your Tales of Xillia love by decorating. Video Tales of Xillia 2 (Alvin) : Gamekyo is a social video game magazine for the Wii, Nintendo DS, PlayStation 2, PlayStation 3, PSP, Xbox 360 and PC. From what I gathered Alvin now owns a bar and lives on Elympios. To use this download, you will need, product code(s) BLUS-31006, NPUB-31136 Alvin - Everybodys favorite backstabbing friend is back in Tales of Xillia 2. To use this download, you will need, product code(s) BLUS-31397, NPUB-31443Īlvin's Baseball Uniform (Tales of Xillia) Equipped attachments can be modified by pressing the START button in the Attachments section of the Equipment Menu.Īlvin's Baseball Uniform (Tales of Xillia 2) Scroll down to the Attachments section of the Equipment Menu to equip costumes and attachments. Access the Downloadable Content section (right most header) of the Items Menu to unlock purchase. Some of them are way too funny and weird to keep to myself, so I though: why not share this abomination and here we are. Basically these are the chats I created with character Ai. Download and use it for your personal or. Alvin (Tales of Xillia) OC Own Character Original Characters Angst Fluff Comedy Crack Summary. Find many great new & used options and get the best deals for poster Tales of Xillia 2 Alvin at the best online prices at eBay Free shipping for many. Purchased items will be automatically installed upon boot-up of the game. Tales Of Xillia Alvin Png, Png Download - Tales Of Xillia 2 Alvin, Transparent Png is free transparent png image. Assist him, and when you head to the store to find him, he will ask you which you like best. Alvin's ready to belt it out of the park in his baseball uniform! Comes with matching hair and helmet. During the cutscene, you will learn Alvin is now a salesman. |
Details
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |